PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A00189.3.p
Common NameEUGRSUZ_A00189, LOC104440295
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 558aa    MW: 60310.3 Da    PI: 6.804
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A00189.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.14.7e-2993146155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Eucgr.A00189.3.p  93 KPRVVWSVELHQQFVSAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 146
                       79*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011012.077129IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23001.0E-6266No hitNo description
PROSITE profilePS5129410.73290149IPR017930Myb domain
SuperFamilySSF466893.4E-2090150IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-3092151IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-2593146IPR006447Myb domain, plants
PfamPF002494.8E-895145IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0071368Biological Processcellular response to cytokinin stimulus
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MKGVTHGACD YLIKPIRIEA LKNIWQHVVR KRKNEWKELE QCGSVEDGDR PQKHLEDVDY  60
SSTANEGSWK SGKRRKEEED DAEERDDSST LKKPRVVWSV ELHQQFVSAV NQLGIDKAVP  120
KKILELMNVP GLTRENVASH LQKYRLYLRR LSGVPQHQAG VNSSFIGTQD AGFGAISSLN  180
GYEIQALAAT GQLAPQSLAT LQAAGLGRSA GKSGISIPML DQRNLFSFDN PKLRFGEGQS  240
QQNLGTNSKQ ANLLHGIPTT MEPKQLVNLQ QSAQSFGSMS MPVHTHGAQS SSLLMPMGQP  300
QARRHVISES GSSRPPVLQA NMGQSIMSTG LVGQALGRSG TAENGRGLGH NTILQTSSAM  360
NFPMNQVSDA PVSSFPIQST FPTSKGGYPE DVNSSIIKGP GGGMPSYDIL HDLQQIRSND  420
WEFQNVGVTF DTSQPGNSVQ GNIDTSGLLL VHQGLSSGQS SNGHNRNISA AGKSLLSADG  480
NRQVTTPNVG QPPTSLVDNP VQIKTEGFPD MSYQAVLYPE HYSQEDIMSA FLKQQQGIGP  540
PDSEFEFDGF SVNNIPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-2292152464ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A00189.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010051575.10.0PREDICTED: two-component response regulator ARR2-like
TrEMBLA0A059DB250.0A0A059DB25_EUCGR; Uncharacterized protein
STRINGGLYMA07G37220.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-129response regulator 2